NIRF Antibody / HRF2

• Description:

  E3 ubiquitin-protein ligase UHRF2 is an enzyme that in humans is encoded by the UHRF2 gene. This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.

• Specifications:

  Western blot: 1-2 µg/mL, Immunofluorescence (FFPE) : 5 µg/mL, Flow cytometry: 1-3ug/million cells

• UniProt:

  Q96PU4

• Host:

  Mouse

• Reactivity:

  Human, Rat

• Immunogen:

  N-terminal region amino acids TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN from the human protein were used as the immunogen for the NIRF antibody.

• Clonality:

  Monoclonal

• Isotype:

  IgG2b

• Clone:

  6B5

• Applications:

  WB, IF, FACS

• Purity:

  Antigen affinity purified

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2% Trehalose

• Reconstitution:

  After reconstitution, the NIRF antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This NIRF antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the NIRF antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the NIRF antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Location:

  Cytoplasmic, nuclear

• Image Legend:

  Immunofluorescent staining of FFPE human HeLa cells with NIRF antibody (green) and DAPI nuclear stain (blue) . HIER: steam section in pH6 citrate buffer for 20 min.