UHRF2 Antibody / NIRF

• Description :

  E3 ubiquitin-protein ligase UHRF2 is an enzyme that in humans is encoded by the UHRF2 gene. This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.

• Specifications :

  Western blot: 0.1-0.5 µg/mL, Immunohistochemistry (FFPE) : 0.5-1 µg/mL

• UniProt :

  Q96PU4

• Host :

  Rabbit

• Reactivity :

  Human, Mouse, Rat

• Immunogen :

  Amino acids TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN of human NIRF/UHRF2 were used as the immunogen for the UHRF2 antibody.

• Clonality :

  Polyclonal

• Isotype :

  IgG

• Applications :

  WB, IHC-P

• Purity :

  Antigen affinity

• Format :

  Antigen affinity purified

• Buffer :

  Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

• Reconstitution :

  After reconstitution, the UHRF2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations :

  This UHRF2 antibody is available for research use only.

• Storage Conditions :

  After reconstitution, the UHRF2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation :

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes :

  Optimal dilution of the UHRF2 antibody should be determined by the researcher.

• CAS Number :

  9007-83-4

• Location :

  Cytoplasmic, minor nuclear

• Image Legend :

  Western blot testing of 1) rat testis and 2) human K562 lysate with UHRF2 antibody. Expected/observed molecular weight ~90 kDa.