UHRF2 Antibody / NIRF

UHRF2 Antibody / NIRF

• Description: E3 ubiquitin-protein ligase UHRF2 is an enzyme that in humans is encoded by the UHRF2 gene. This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.
• CAS Number: 9007-83-4
• UniProt: Q96PU4
• Host: Rabbit
• Immunogen: Amino acids TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN of human NIRF/UHRF2 were used as the immunogen for the UHRF2 antibody.
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB, IHC-P
• Format: Antigen affinity purified
• Buffer: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Reconstitution: After reconstitution, the UHRF2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
• Limitations: This UHRF2 antibody is available for research use only.