ULK1 Antibody

• Description:

  ULK1 is an enzyme that in humans is encoded by the ULK1 gene. It is mapped to 12q24.33. Unc-51 like autophagy activating kinase (ULK1/2) are two similar isoforms of an enzyme that in humans are encoded by the ULK1/2 genes. It is specifically a kinase that is involved with autophagy, particularly in response to amino acid withdrawal. Not many studies have been done comparing the two isoforms, but some differences have been recorded.

• Specifications:

  Western blot: 0.5-1 µg/mL, Immunohistochemistry: 1-2 µg/mL, Flow cytometry: 1-3ug/million cells

• UniProt:

  O75385

• Host:

  Rabbit

• Reactivity:

  Human, Mouse, Rat

• Immunogen:

  Amino acids EETLMEQEHTEILRGLRFTLLFVQHVLEIAALK from the human protein were used as the immunogen for the ULK1 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB, IHC-P, FACS

• Purity:

  Affinity purified

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

• Reconstitution:

  After reconstitution, the ULK1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This ULK1 antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the ULK1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the ULK1 antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Location:

  Cytoplasmic

• Image Legend:

  IHC staining of FFPE human lung cancer with ULK1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.