ULK1 Antibody
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


ULK1 Antibody
Description :
ULK1 is an enzyme that in humans is encoded by the ULK1 gene. It is mapped to 12q24.33. Unc-51 like autophagy activating kinase (ULK1/2) are two similar isoforms of an enzyme that in humans are encoded by the ULK1/2 genes. It is specifically a kinase that is involved with autophagy, particularly in response to amino acid withdrawal. Not many studies have been done comparing the two isoforms, but some differences have been recorded.Specifications :
Western blot: 0.5-1 µg/mL, Immunohistochemistry: 1-2 µg/mL, Flow cytometry: 1-3ug/million cellsUniProt :
O75385Host :
RabbitReactivity :
Human, Mouse, RatImmunogen :
Amino acids EETLMEQEHTEILRGLRFTLLFVQHVLEIAALK from the human protein were used as the immunogen for the ULK1 antibody.Clonality :
PolyclonalIsotype :
IgGApplications :
WB, IHC-P, FACSPurity :
Affinity purifiedFormat :
Antigen affinity purifiedBuffer :
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azideReconstitution :
After reconstitution, the ULK1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.Limitations :
This ULK1 antibody is available for research use only.Storage Conditions :
After reconstitution, the ULK1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.Formulation :
0.5 mg/mL if reconstituted with 0.2ml sterile DI waterApplications Notes :
Optimal dilution of the ULK1 antibody should be determined by the researcher.CAS Number :
9007-83-4Location :
CytoplasmicImage Legend :
IHC staining of FFPE human lung cancer with ULK1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

