ACTN3 Antibody / Alpha Actinin 3

• Description:

  Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.

• Specifications:

  Western blot: 0.5-1 µg/mL, IHC (FFPE) : 1-2 µg/mL

• UniProt:

  Q08043

• Host:

  Mouse

• Reactivity:

  Mouse, Rat

• Immunogen:

  Amino acids EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK were used as the immunogen for the ACTN3 antibody.

• Clonality:

  Monoclonal

• Isotype:

  IgG1

• Clone:

  9B5

• Applications:

  WB, IHC-P

• Purity:

  Protein G affinity

• Format:

  Purified

• Buffer:

  Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

• Reconstitution:

  After reconstitution, the ACTN3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Storage Conditions:

  After reconstitution, the ACTN3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the ACTN3 antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Location:

  Cytoplasmic, extracellular

• Image Legend:

  Western blot tesing of 1) rat skeletal muscle and 2) mouse skeletal muscle lysate with ACTN3 antibody at 0.5ug/ml. Predicted molecular weight ~103 kDa.