ACTN3 Antibody

• Description:

  Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.

• Specifications:

  Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL, Flow cytometry: 1-3ug/million cells, Immunofluorescence: 5 µg/mL

• UniProt:

  Q08043

• Host:

  Rabbit

• Reactivity:

  Human, Mouse, Rat

• Immunogen:

  Amino acids 574-617 (EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK) from the human protein were used as the immunogen for the ACTN3 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB, IHC-P, FACS, IF

• Purity:

  Antigen affinity

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

• Reconstitution:

  After reconstitution, the ACTN3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This ACTN3 antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the ACTN3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Differences in protocols and secondary/substrate sensitivity may require the ACTN3 antibody to be titrated for optimal performance.

• CAS Number:

  9007-83-4

• Location:

  Cytoplasmic, extracellular

• Image Legend:

  Immunofluorescent staining of FFPE mouse skeletal muscle tissue with ACTN3 antibody (green) and DAPI nuclear stain (blue) . HIER: steam section in pH8 EDTA buffer for 20 min.