FGF9 Antibody

• Description :

  FGF 9, Fibroblast growth factor 9, is a protein that in humans is encoded by the FGF9 gene. The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. The FGF 9 gene contains 3 exons. By radioactive chromosomal in situ hybridization, the FGF 9 gene is mapped to chromosome 13q11-q12. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling.

• Specifications :

  Western blot: 0.5-1 µg/mL

• UniProt :

  P31371

• Host :

  Rabbit

• Reactivity :

  Human, Mouse, Rat

• Immunogen :

  Amino acids DHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLY were used as the immunogen for the FGF9 antibody.

• Clonality :

  Polyclonal

• Isotype :

  IgG

• Applications :

  WB

• Purity :

  Antigen affinity

• Format :

  Antigen affinity purified

• Buffer :

  Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

• Reconstitution :

  After reconstitution, the FGF9 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations :

  This FGF9 antibody is available for research use only.

• Storage Conditions :

  After reconstitution, the FGF9 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation :

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes :

  Optimal dilution of the FGF9 antibody should be determined by the researcher.

• CAS Number :

  9007-83-4

• Location :

  Secreted

• Image Legend :

  Western blot testing of 1) human COLO-320, 2) rat brain and 3) mouse brain lysate with FGF9 antibody at 0.5ug/ml. Predicted molecular weight ~23 kDa with a possible 45-55 kDa dimer.