Cdc20 Antibody

• Description:

  The cell-division cycle protein 20, also known as p55CDC, is an essential regulator of cell division that is encoded by the CDC20 gene in humans. The chromosomal assignment of human CDC20 is 1p34.2. CDC20 is a component of the mammalian cell cycle mechanism. CDC20 appears to act as a regulatory protein interacting with many other proteins at multiple points in the cell cycle. This gene's most important function is to activate the anaphase promoting complex (APC), a large 11-13 subunit complex that initiates chromatid separation and entrance into anaphase.

• Specifications:

  Western Blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL, Immunofluorescence: 2-4 µg/mL, Flow cytometry: 1-3ug/10^6 cells

• UniProt:

  Q12834

• Host:

  Rabbit

• Reactivity:

  Human, Mouse, Rat

• Immunogen:

  Amino acids QTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKAT were used as the immunogen for the Cdc20 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB, IHC-P, IF, FACS

• Purity:

  Antigen affinity

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

• Reconstitution:

  After reconstitution, the Cdc20 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This Cdc20 antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the Cdc20 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the Cdc20 antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Image Legend:

  Western blot testing of human HeLa cell lysate with Cdc20 antibody at 0.5ug/ml. Predicted molecular weight ~55 kDa.