ETS1 Antibody

• Description :

  Protein C-ets-1 is a protein that in humans is encoded by the ETS1 gene. It is mapped to 11q24.3. This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis.

• Specifications :

  Western blot: 0.5-1 µg/mL

• UniProt :

  P14921

• Host :

  Rabbit

• Reactivity :

  Human, Mouse

• Immunogen :

  Amino acids 67-98 (KDPRQWTETHVRDWVMWAVNEFSLKGVDFQKF) from the human protein were used as the immunogen for the ETS1 antibody.

• Clonality :

  Polyclonal

• Isotype :

  IgG

• Applications :

  WB

• Purity :

  Antigen affinity

• Format :

  Antigen affinity purified

• Buffer :

  Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

• Reconstitution :

  After reconstitution, the ETS1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations :

  This ETS1 antibody is available for research use only.

• Storage Conditions :

  After reconstitution, the ETS1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation :

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes :

  Optimal dilution of the ETS1 antibody should be determined by the researcher.

• CAS Number :

  9007-83-4

• Image Legend :

  Western blot testing of 1) mouse NIH3T3 and 2) human A375 lysate with ETS1 antibody at 0.5ug/ml. Predicted molecular weight ~51 kDa.