ETS1 Antibody

• Description:

  Protein C-ets-1 is a protein that in humans is encoded by the ETS1 gene. It is mapped to 11q24.3. This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis.

• Specifications:

  Western blot: 0.5-1 µg/mL

• UniProt:

  P14921

• Host:

  Rabbit

• Reactivity:

  Human, Mouse

• Immunogen:

  Amino acids 67-98 (KDPRQWTETHVRDWVMWAVNEFSLKGVDFQKF) from the human protein were used as the immunogen for the ETS1 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB

• Purity:

  Antigen affinity

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

• Reconstitution:

  After reconstitution, the ETS1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This ETS1 antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the ETS1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the ETS1 antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Image Legend:

  Western blot testing of 1) mouse NIH3T3 and 2) human A375 lysate with ETS1 antibody at 0.5ug/ml. Predicted molecular weight ~51 kDa.