PDGF beta Antibody
CAT:
800-R32656
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




PDGF beta Antibody
- Description: Platelet-derived growth factor subunit B is a protein that in humans is encoded by the PDGFB gene. The protein encoded by this gene is a member of the platelet-derived growth factor family. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. This gene is mapped to 22q13.1. Growth factor plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. This gene plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.
- CAS Number: 9007-83-4
- UniProt: P01127
- Host: Rabbit
- Immunogen: Amino acids 89-129 (AEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQR) from the human protein were used as the immunogen for the PDGF beta antibody.
- Clonality: Polyclonal
- Isotype: IgG
- Applications: WB
- Format: Antigen affinity purified
- Buffer: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
- Reconstitution: After reconstitution, the PDGF beta antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
- Limitations: This PDGF beta antibody is available for research use only.