LRIG3 Antibody

• Description:

  LRIG3 (leucine-rich repeats and Ig-like domains-3) is a 140 kDa type I transmembrane glycoprotein member of the mammalian LRIG glycoprotein family. It shares 46.8% and 54.0% amino acid identity with LRIG1 and LRIG2, respectively, with highest conservation in the extracellular, transmembrane, and membrane-proximal sequences. This gene is mapped to chromosome 12q13.2. LRIG3 may play a role in craniofacial and inner ear morphogenesis during embryonic development. It also may act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1.

• Specifications:

  Western blot: 0.5-1 µg/mL

• UniProt:

  Q6UXM1

• Host:

  Rabbit

• Reactivity:

  Human, Rat

• Immunogen:

  Amino acids 428-465 (NAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQ from the human protein were used as the immunogen for the LRIG3 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB

• Purity:

  Antigen affinity

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

• Reconstitution:

  After reconstitution, the LRIG3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This LRIG3 antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the LRIG3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Differences in protocols and secondary/substrate sensitivity may require the LRIG3 antibody to be titrated for optimal performance.

• CAS Number:

  9007-83-4

• Location:

  Cytoplasmic, membranous

• Image Legend:

  Western blot testing of 1) rat testis and 2) human HepG2 lysate with LRIG3 antibody at 0.5ug/ml. Observed molecular weight: ~123 kDa (precursor), 140-170 kDa (glycosylated) .