CCDC6 Antibody
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


CCDC6 Antibody
Description :
Coiled-coil domain-containing protein 6 is a protein that in humans is encoded by the CCDC6 gene. This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.CAS Number :
9007-83-4Specifications :
Western blot: 0.5-1 µg/mLUniProt :
Q16204Host :
RabbitReactivity :
Human, RatImmunogen :
Amino acids 156-198 (KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRRE) from the human protein were used as the immunogen for the CCDC6 antibody.Clonality :
PolyclonalIsotype :
IgGApplications :
WBPurity :
Antigen affinityFormat :
Antigen affinity purifiedBuffer :
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azideReconstitution :
After reconstitution, the CCDC6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.Limitations :
This CCDC6 antibody is available for research use only.Storage Conditions :
After reconstitution, the CCDC6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.Formulation :
0.5 mg/mL if reconstituted with 0.2ml sterile DI waterApplications Notes :
Differences in protocols and secondary/substrate sensitivity may require the CCDC6 antibody to be titrated for optimal performance.Location :
CytoplasmicImage Legend :
Western blot testing of 1) rat testis and 2) human MCF7 lysate with CCDC6 antibody at 0.5ug/ml. Predicted molecular weight ~53 kDa, routinely observed at ~65 kDa.

