CCDC6 Antibody

• Description:

  Coiled-coil domain-containing protein 6 is a protein that in humans is encoded by the CCDC6 gene. This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.

• UniProt:

  Q16204

• Host:

  Rabbit

• Immunogen:

  Amino acids 156-198 (KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRRE) from the human protein were used as the immunogen for the CCDC6 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB

• Format:

  Antigen affinity purified

• Buffer:

  0.5mg/ml if reconstituted with 0.2ml sterile DI water

• Reconstitution:

  After reconstitution, the CCDC6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This CCDC6 antibody is available for research use only.

• CAS Number:

  9007-83-4