CCDC6 Antibody

• Description :

  Coiled-coil domain-containing protein 6 is a protein that in humans is encoded by the CCDC6 gene. This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.

• Specifications :

  Western blot: 0.5-1 µg/mL

• UniProt :

  Q16204

• Host :

  Rabbit

• Reactivity :

  Human, Rat

• Immunogen :

  Amino acids 156-198 (KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRRE) from the human protein were used as the immunogen for the CCDC6 antibody.

• Clonality :

  Polyclonal

• Isotype :

  IgG

• Applications :

  WB

• Purity :

  Antigen affinity

• Format :

  Antigen affinity purified

• Buffer :

  Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

• Reconstitution :

  After reconstitution, the CCDC6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations :

  This CCDC6 antibody is available for research use only.

• Storage Conditions :

  After reconstitution, the CCDC6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation :

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes :

  Differences in protocols and secondary/substrate sensitivity may require the CCDC6 antibody to be titrated for optimal performance.

• CAS Number :

  9007-83-4

• Location :

  Cytoplasmic

• Image Legend :

  Western blot testing of 1) rat testis and 2) human MCF7 lysate with CCDC6 antibody at 0.5ug/ml. Predicted molecular weight ~53 kDa, routinely observed at ~65 kDa.