RAGE Antibody
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


RAGE Antibody
Description:
The receptor for advanced glycation end products (RAGE) is a multi-ligand member of the immunoglobulin superfamily of cell surface molecules. It interacts with distinct molecules implicated in homeostasis, development and inflammation, and certain diseases such as diabetes and Alzheimer's disease. RAGE is also a central cell surface receptor for amphoterin and EN-RAGE. And RAGE is associated with sustained NF-kappaB activation in the diabetic microenvironment and has a central role in sensory neuronal dysfunction. Moreover, RAGE propagates cellular dysfunction in several inflammatory disorders and diabetes, and it also functions as an endothelial adhesion receptor promoting leukocyte recruitment.Specifications:
Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mLUniProt:
Q15109Host:
RabbitReactivity:
Human, Mouse, RatImmunogen:
Amino acids IQDEGIFRCQAMNRNGKETKSNYRVRVYQI of human RAGE were used as the immunogen for the RAGE antibody.Clonality:
PolyclonalIsotype:
IgGApplications:
WB, IHC-PPurity:
Antigen affinityFormat:
Antigen affinity purifiedBuffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azideReconstitution:
After reconstitution, the RAGE antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.Limitations:
This RAGE antibody is available for research use only.Storage Conditions:
After reconstitution, the RAGE antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.Formulation:
0.5 mg/mL if reconstituted with 0.2ml sterile DI waterApplications Notes:
Optimal dilution of the RAGE antibody should be determined by the researcher.CAS Number:
9007-83-4Location:
Cytoplasmic, membraneImage Legend:
Western blot testing of 1) rat lung, 2) human RH35 and 3) HeLa lysate with RAGE antibody. Predicted molecular weight: 45-55 kDa depending on glycosylation level.
