STAT1 Antibody

CAT:
800-R32095
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
STAT1 Antibody - image 1

STAT1 Antibody

  • Description :

    The crystal structure of the DNA complex of a 67-kD core fragment of the STAT1 homodimer was determined, lacking only the N-domain and the C-terminal transcriptional activation domain, at 2.9-angstrom resolution. Phosphorylation of Signal Transducer and Activator of transcription 1 (STAT 1) was also decreased in rheumatoid arthritis lymphocytes. The transcription factor signal transducer and activator of transcription-1 (STAT1) plays a key role in immunity against mycobacterial and viral infections. Activation of the signal transducers and activators of transcription (STAT) pathway is important in fibroblast growth factor (FGF) modulation of chondrocyte proliferation and endochondral bone formation during embryogenesis.
  • CAS Number :

    9007-83-4
  • Specifications :

    Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mL
  • UniProt :

    P42224
  • Host :

    Rabbit
  • Reactivity :

    Human, Mouse, Rat
  • Immunogen :

    Amino acids KILENAQRFNQAQSGNIQSTVMLDKQKELD of human STAT1 were used as the immunogen for the STAT1 antibody.
  • Clonality :

    Polyclonal
  • Isotype :

    IgG
  • Applications :

    WB, IHC-P
  • Purity :

    Antigen affinity
  • Format :

    Antigen affinity purified
  • Buffer :

    Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
  • Reconstitution :

    After reconstitution, the STAT1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations :

    This STAT1 antibody is available for research use only.
  • Storage Conditions :

    After reconstitution, the STAT1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation :

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes :

    Optimal dilution of the STAT1 antibody should be determined by the researcher.
  • Location :

    Cytoplasmic
  • Image Legend :

    Western blot testing of rat 1) testis, 2) brain, 3) liver, and human 4) placenta, 5) MCF7, and 6) SW620 lysate with STAT1 antibody. Predicted/observed molecular weight: ~91/84 kDa (alpha/beta) .

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide