PACE4 Antibody / PCSK6

CAT:
800-R32047
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PACE4 Antibody / PCSK6 - image 1

PACE4 Antibody / PCSK6

  • Description:

    Proprotein convertase subtilisin/kexin type 6 is an enzyme that in humans is encoded by the PCSK6 gene. This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the trans-Golgi network where a second autocatalytic event takes place and the catalytic activity is acquired. The encoded protease is constitutively secreted into the extracellular matrix and expressed in many tissues, including neuroendocrine, liver, gut, and brain. This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues. Some of its substrates include transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression and left-right patterning. Alternatively spliced transcript variants encoding different isoforms have been identified.
  • Specifications:

    Western blot: 0.1-0.5 µg/mL
  • UniProt:

    P29122
  • Host:

    Rabbit
  • Reactivity:

    Human, Rat
  • Immunogen:

    Amino acids RNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLE of human PCSK6/PACE4 were used as the immunogen for the PACE4 antibody.
  • Clonality:

    Polyclonal
  • Isotype:

    IgG
  • Applications:

    WB
  • Purity:

    Antigen affinity
  • Format:

    Antigen affinity purified
  • Buffer:

    Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
  • Reconstitution:

    After reconstitution, the PACE4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations:

    This PACE4 antibody is available for research use only.
  • Storage Conditions:

    After reconstitution, the PACE4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation:

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes:

    Optimal dilution of the PACE4 antibody should be determined by the researcher.
  • CAS Number:

    9007-83-4
  • Image Legend:

    Western blot testing of 1) rat brain and 2) human 293 lysate with PACE4 antibody. Expected molecular weight: ~106/105 kDa (isoforms PACE4A-I/II), ~72 kDa (isoform PACE4C), ~55 kDa (isoform PACE4D) .