PIGR Antibody

• Description :

  Polymeric immunoglobulin receptor is a protein that in humans is encoded by the PIGR gene. It is a Fc receptor which facilitates the secretion of the soluble polymeric isoforms of immunoglobulin A and immunoglobulin M. This gene is mapped to 1q31-q41. The encoded poly-Ig receptor binds polymeric immunoglobulin molecules at the basolateral surface of epithelial cells; the complex is then transported across the cell to be secreted at the apical surface. A significant association was found between immunoglobulin A nephropathy and several SNPs in this gene.

• Specifications :

  Western blot: 0.1-0.5 µg/mL

• UniProt :

  P01833

• Host :

  Rabbit

• Reactivity :

  Human

• Immunogen :

  Amino acids DAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVAD of human PIGR were used as the immunogen for the PIGR antibody.

• Clonality :

  Polyclonal

• Isotype :

  IgG

• Applications :

  WB

• Purity :

  Antigen affinity

• Format :

  Antigen affinity purified

• Buffer :

  Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

• Reconstitution :

  After reconstitution, the PIGR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations :

  This PIGR antibody is available for research use only.

• Storage Conditions :

  After reconstitution, the PIGR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation :

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes :

  Optimal dilution of the PIGR antibody should be determined by the researcher.

• CAS Number :

  9007-83-4

• Image Legend :

  Western blot testing of human 1) HeLa, 2) SKOV, 3) MCF7, and 4) SW620 cell lysate with PIGR antibody. Expected/observed molecular weight ~83 kDa.