PIGR Antibody

CAT:
800-R31866
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PIGR Antibody - image 1

PIGR Antibody

  • Description :

    Polymeric immunoglobulin receptor is a protein that in humans is encoded by the PIGR gene. It is a Fc receptor which facilitates the secretion of the soluble polymeric isoforms of immunoglobulin A and immunoglobulin M. This gene is mapped to 1q31-q41. The encoded poly-Ig receptor binds polymeric immunoglobulin molecules at the basolateral surface of epithelial cells; the complex is then transported across the cell to be secreted at the apical surface. A significant association was found between immunoglobulin A nephropathy and several SNPs in this gene.
  • Specifications :

    Western blot: 0.1-0.5 µg/mL
  • UniProt :

    P01833
  • Host :

    Rabbit
  • Reactivity :

    Human
  • Immunogen :

    Amino acids DAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVAD of human PIGR were used as the immunogen for the PIGR antibody.
  • Clonality :

    Polyclonal
  • Isotype :

    IgG
  • Applications :

    WB
  • Purity :

    Antigen affinity
  • Format :

    Antigen affinity purified
  • Buffer :

    Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
  • Reconstitution :

    After reconstitution, the PIGR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations :

    This PIGR antibody is available for research use only.
  • Storage Conditions :

    After reconstitution, the PIGR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation :

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes :

    Optimal dilution of the PIGR antibody should be determined by the researcher.
  • CAS Number :

    9007-83-4
  • Image Legend :

    Western blot testing of human 1) HeLa, 2) SKOV, 3) MCF7, and 4) SW620 cell lysate with PIGR antibody. Expected/observed molecular weight ~83 kDa.

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide