Cd46 AntibodyCd46 Antibody - High-quality laboratory reagent available from Gentaur. Catalog: 800-R31841.800-R31841800-R31841Business & Industrial > Science & LaboratoryCd46 Antibody
Gentaur
EUR12027-02-21

Cd46 Antibody

CAT:
800-R31841
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Cd46 Antibody - image 1

Cd46 Antibody

  • Description:

    CD46 complement regulatory protein, also known as CD46 (cluster of differentiation 46) andMembrane Cofactor Protein, is aproteinwhich in humans is encoded by the CD46 gene. The protein encoded by this gene is a type I membrane protein and is a regulatory part of the complement system. And the encoded protein has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. In addition, the encoded protein can act as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseria. Finally, the protein encoded by this gene may be involved in the fusion of the spermatozoa with the oocyte during fertilization. Mutations at this locus have been associated with susceptibility to hemolytic uremic syndrome. Alternatively spliced transcript variants encoding different isoforms have been described.
  • Specifications:

    Western blot: 0.1-0.5 µg/mL
  • UniProt:

    O88174
  • Host:

    Rabbit
  • Reactivity:

    Mouse
  • Immunogen:

    Amino acids ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK of mouse Cd46 were used as the immunogen for the Cd46 antibody.
  • Clonality:

    Polyclonal
  • Isotype:

    IgG
  • Applications:

    WB
  • Purity:

    Antigen affinity
  • Format:

    Antigen affinity purified
  • Buffer:

    Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
  • Reconstitution:

    After reconstitution, the Cd46 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations:

    This Cd46 antibody is available for research use only.
  • Storage Conditions:

    After reconstitution, the Cd46 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation:

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes:

    Optimal dilution of the Cd46 antibody should be determined by the researcher.
  • CAS Number:

    9007-83-4
  • Image Legend:

    Western blot testing of 1) mouse testis and 2) mouse NIH3T3 lysate with Cd46 antibody. Observed molecular weight: 41~70 kDa depending on glycosylation level.