RUNX1 Antibody

CAT:
800-R31576
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
RUNX1 Antibody - image 1
RUNX1 Antibody - image 2
Thumbnail 1
Thumbnail 2

RUNX1 Antibody

  • Description:

    Runt-related transcription factor 1, also known as AML1 or CBFA2, is a protein that in humans is encoded by the RUNX1 gene. It belongs to the Runt-related transcription factor (RUNX) family of genes which are also called Core binding factor alpha (CBFa). RUNX1 is a transcription factor that regulates the differentiation of hematopoietic stem cells into mature blood cells. RUNX proteins form a heterodimeric complex with CBFb which confers increased DNA binding and stability to the complex. Chromosomal translocations involving the gene are associated with several types of leukemia including M2 AML. Mutations are implicated in cases of breast cancer.
  • CAS Number:

    9007-83-4
  • Host:

    Rabbit
  • Immunogen:

    An amino acid sequence from the middle region of human RUNX1 (ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN) was used as the immunogen for this RUNX1 antibody (100% homologous in human, mouse and rat).
  • Clonality:

    Polyclonal
  • Isotype:

    IgG
  • Applications:

    WB, IHC-P, IHC-F
  • Format:

    Antigen affinity purified
  • Buffer:

    0.5mg/ml if reconstituted with 0.2ml sterile DI water
  • Reconstitution:

    After reconstitution, the RUNX1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations:

    This RUNX1 antibody is available for research use only.