Recombinant Daboia palaestinae Disintegrin viperistatin
CAT:
399-CSB-EP313683VDK-01
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Daboia palaestinae Disintegrin viperistatin
- CAS Number: 9000-83-3
- UniProt: P0C6E2
- Expression Region: 1-41aa
- Organism: Daboia palaestinae (Palestine viper) (Vipera palaestinae)
- Target Sequence: CTTGPCCRQCKLKPAGTTCWKTSRTSHYCTGKSCDCPVYQG
- Tag: N-terminal 6xHis-KSI-tagged
- Source: E.coli
- Field of Research: Others
- Assay Type: Developed Protein
- Relevance: Potent and highly selective inhibitor of alpha-1/beta-1 (ITGA1/ITGB1) integrin binding to collagen I and IV. Is about 25-fold more potent than obtustatin inhibiting the binding of this integrin to collagen IV.
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Full Length
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 19.8 kDa
- References & Citations: "Structural determinants of the selectivity of KTS-disintegrins for the alpha1beta1 integrin." Kisiel D.G., Calvete J.J., Katzhendler J., Fertala A., Lazarovici P., Marcinkiewicz C. FEBS Lett. 577:478-482 (2004)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.