Recombinant Daboia palaestinae Disintegrin viperistatin

• UniProt:

  P0C6E2

• Expression Region:

  1-41aa

• Organism:

  Daboia palaestinae (Palestine viper) (Vipera palaestinae)

• Target Sequence:

  CTTGPCCRQCKLKPAGTTCWKTSRTSHYCTGKSCDCPVYQG

• Tag:

  C-terminal 6xHis-Myc-tagged

• Source:

  Yeast

• Field of Research:

  Others

• Assay Type:

  Developed Protein

• Relevance:

  Potent and highly selective inhibitor of alpha-1/beta-1 (ITGA1/ITGB1) integrin binding to collagen I and IV. Is about 25-fold more potent than obtustatin inhibiting the binding of this integrin to collagen IV.

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Length:

  Full Length

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  8.2 kDa

• References & Citations:

  "Structural determinants of the selectivity of KTS-disintegrins for the alpha1beta1 integrin." Kisiel D.G., Calvete J.J., Katzhendler J., Fertala A., Lazarovici P., Marcinkiewicz C. FEBS Lett. 577:478-482 (2004)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

• CAS Number:

  9000-83-3