Recombinant Daboia palaestinae Disintegrin viperistatin

CAT:
399-CSB-YP313683VDK-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Daboia palaestinae Disintegrin viperistatin - image 1

Recombinant Daboia palaestinae Disintegrin viperistatin

  • Abbreviation:

    Recombinant Daboia palaestinae Disintegrin viperistatin protein
  • UniProt:

    P0C6E2
  • Expression Region:

    1-41aa
  • Organism:

    Daboia palaestinae (Palestine viper) (Vipera palaestinae)
  • Target Sequence:

    CTTGPCCRQCKLKPAGTTCWKTSRTSHYCTGKSCDCPVYQG
  • Tag:

    C-terminal 6xHis-Myc-tagged
  • Type:

    Developed Protein
  • Source:

    Yeast
  • Field of Research:

    Others
  • Relevance:

    Potent and highly selective inhibitor of alpha-1/beta-1 (ITGA1/ITGB1) integrin binding to collagen I and IV. Is about 25-fold more potent than obtustatin inhibiting the binding of this integrin to collagen IV.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    8.2 kDa
  • References & Citations:

    "Structural determinants of the selectivity of KTS-disintegrins for the alpha1beta1 integrin." Kisiel D.G., Calvete J.J., Katzhendler J., Fertala A., Lazarovici P., Marcinkiewicz C. FEBS Lett. 577:478-482 (2004)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length