Recombinant Human Glucagon-like peptide 1 receptor (GLP1R) , partial (Active)

• Gene Name:

  GLP1R

• UniProt:

  P43220

• Expression Region:

  24-145aa

• Organism:

  Homo sapiens

• Target Sequence:

  RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

• Tag:

  N-terminal 10xHis-tagged and C-terminal Myc-tagged

• Source:

  Mammalian cell

• Field of Research:

  Cardiovascular

• Assay Type:

  Active Protein & In Stock Protein

• Relevance:

  G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels.

• Endotoxin:

  Less than 1.0 EU/ug as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  Measured by its binding ability in a functional ELISA. Immobilized Human GLP1R at 2 μg/mL can bind Anti-GLP1R recombinant antibody (CSB-RA009514MA1HU), the EC50 is 54.54-94.23 ng/mL.

• Length:

  Partial

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  19.3 kDa

• References & Citations:

  "Characterization of the 5-HT6 receptor coupled to Ca2+ signaling using an enabling chimeric G-protein." Zhang J.Y., Nawoschik S., Kowal D., Smith D., Spangler T., Ochalski R., Schechter L., Dunlop J. Eur J Pharmacol 472:33-38 (2003)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

• Protein Length:

  Partial

• CAS Number:

  9000-83-3