Recombinant Human Glucagon-like peptide 1 receptor (GLP1R) , partial (Active)

CAT:
399-CSB-MP009514HUb1-03
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Glucagon-like peptide 1 receptor (GLP1R) , partial (Active) - image 1
Recombinant Human Glucagon-like peptide 1 receptor (GLP1R) , partial (Active) - image 2
Recombinant Human Glucagon-like peptide 1 receptor (GLP1R) , partial (Active) - image 3
Recombinant Human Glucagon-like peptide 1 receptor (GLP1R) , partial (Active) - image 4
Thumbnail 1
Thumbnail 2
Thumbnail 3
Thumbnail 4

Recombinant Human Glucagon-like peptide 1 receptor (GLP1R) , partial (Active)

  • Gene Name:

    GLP1R
  • UniProt:

    P43220
  • Expression Region:

    24-145aa
  • Organism:

    Homo sapiens
  • Target Sequence:

    RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged
  • Source:

    Mammalian cell
  • Field of Research:

    Cardiovascular
  • Assay Type:

    Active Protein & In Stock Protein
  • Relevance:

    G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels.
  • Endotoxin:

    Less than 1.0 EU/ug as determined by LAL method.
  • Purity:

    Greater than 95% as determined by SDS-PAGE.
  • Activity:

    Yes
  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Human GLP1R at 2 μg/mL can bind Anti-GLP1R recombinant antibody (CSB-RA009514MA1HU), the EC50 is 54.54-94.23 ng/mL.
  • Length:

    Partial
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    19.3 kDa
  • References & Citations:

    "Characterization of the 5-HT6 receptor coupled to Ca2+ signaling using an enabling chimeric G-protein." Zhang J.Y., Nawoschik S., Kowal D., Smith D., Spangler T., Ochalski R., Schechter L., Dunlop J. Eur J Pharmacol 472:33-38 (2003)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • Protein Length:

    Partial
  • CAS Number:

    9000-83-3