Tau-383 (0N4R) Wild-Type Monomers
CAT:
400-SPR-509C
Size:
2x 100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: Yes






Tau-383 (0N4R) Wild-Type Monomers
- Background: Several tau isoforms, including 0N4R, are expressed in the human brain, and the existence of multiple human tauopathies with distinct fibril morphologies suggests different molecular conformers incorporating different isoforms may exist (1, 2). NMR data indicates that both 3R and 4R tau are incorporated into AD-tau seeded fibrils (3).
- Description: Human Recombinant Tau-383 (0N4R) Wild-Type Monomers
- Product Name Alternative: Tau-D, Tau 383
- UNSPSC: 12352202
- Swiss Prot: P10636-6
- Host: E. coli
- Origin Species: Human
- Target: Tau-383 (0N4R)
- Conjugation: No Tag
- Sequence: MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
- Applications: WB, SDS PAGE, In vitro Assay
- Purification Method: Ion-exchange Purified
- Concentration: 2 mg/ml
- Purity: >95%
- Weight: 0.02
- Length: 383 aa
- Buffer: 10mM Hepes pH 7.4, 100mM NaCl
- Molecular Weight: 40.007 kDa
- Precautions: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
- Additionnal Information: For corresponding PFFs, see catalog# SPR-510
- References & Citations: 1. Goedert et al. 1989. Multiple isoforms of human microtubule-associated protein tau: sequences and localization in neurofibrillary tangles of Alzheimer’s disease. Neuron. DOI: 10.1016/0896-6273(89)90210-9 2. Goedert, Eisenberg and Crowther. 2017. Propagation of Tau Aggregates and Neurodegeneration. Annual Review of Neuroscience. DOI: 10.1146/annurev-neuro-072116-031153 3. Dregni et al. 2022. Fluent molecular mixing of Tau isoforms in Alzheimer’s disease neurofibrillary tangles. Nature communications. DOI: 10.1038/s41467-022-30585-0