Tau-383 (0N4R) Wild-Type Monomers

• Background:

  Several tau isoforms, including 0N4R, are expressed in the human brain, and the existence of multiple human tauopathies with distinct fibril morphologies suggests different molecular conformers incorporating different isoforms may exist (1, 2) . NMR data indicates that both 3R and 4R tau are incorporated into AD-tau seeded fibrils (3) .

• Description:

  Human Recombinant Tau-383 (0N4R) Wild-Type Monomers

• Product Name Alternative:

  Tau-D, Tau 383

• UNSPSC:

  12352202

• UN Code:

  Non-hazardous

• Hazard Statement:

  Non-hazardous

• Swiss Prot:

  P10636-6

• Expression System:

  E. coli

• Host:

  E. coli

• Origin Species:

  Human

• Target:

  Tau-383 (0N4R)

• Conjugation:

  No Tag

• Nature:

  Recombinant

• Sequence:

  MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL

• Applications:

  WB | SDS PAGE | In vitro Assay

• Field of Research:

  Neuroscience | Neurodegeneration | Alzheimer's Disease | Tangles & Tau

• Purification Method:

  Ion-exchange Purified

• Purification:

  Ion-exchange Purified

• Limit Of Detection:

  Protein certified >95% pure on SDS-PAGE & Nanodrop analysis. Low endotoxin <5 EU/mL @ 2mg/mL.

• Concentration:

  2 mg/ml

• Purity:

  >95%

• Weight:

  0.01

• Length:

  383 aa

• Buffer:

  10mM Hepes pH 7.4, 100mM NaCl

• Molecular Weight:

  40.007 kDa

• Precautions:

  Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

• Additionnal Information:

  For corresponding PFFs, see catalog# SPR-510

• References & Citations:

  1. Goedert et al. 1989. Multiple isoforms of human microtubule-associated protein tau: sequences and localization in neurofibrillary tangles of Alzheimer’s disease. Neuron. DOI: 10.1016/0896-6273(89)90210-9 2. Goedert, Eisenberg and Crowther. 2017. Propagation of Tau Aggregates and Neurodegeneration. Annual Review of Neuroscience. DOI: 10.1146/annurev-neuro-072116-031153 3. Dregni et al. 2022. Fluent molecular mixing of Tau isoforms in Alzheimer’s disease neurofibrillary tangles. Nature communications. DOI: 10.1038/s41467-022-30585-0

• Shipping Conditions:

  Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.

• Storage Conditions:

  -80ºC

• Notes:

  For corresponding PFFs, see catalog# SPR-510

• Protein Length:

  383 aa

• Background Reference 01:

  1. Goedert et al. 1989. Multiple isoforms of human microtubule-associated protein tau: sequences and localization in neurofibrillary tangles of Alzheimer’s disease. Neuron. DOI: 10.1016/0896-6273 (89) 90210-9 2. Goedert, Eisenberg and Crowther. 2017. Propagation of Tau Aggregates and Neurodegeneration. Annual Review of Neuroscience. DOI: 10.1146/annurev-neuro-072116-031153 3. Dregni et al. 2022. Fluent molecular mixing of Tau isoforms in Alzheimer’s disease neurofibrillary tangles. Nature communications. DOI: 10.1038/s41467-022-30585-0

• AA Sequence:

  MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL

• Immunogen Species:

  Human