EIF5A2, Human (His)

CAT:
804-HY-P70910
Size:
1 Each
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
EIF5A2, Human (His) - image 1

EIF5A2, Human (His)

  • Description :

    EIF5A2 is a translation factor critical for promoting elongation and termination, helping stalled ribosomes encounter specific amino acid environments. EIF5A2 is located between the ribosome exit (E) and peptidyl (P) sites and rescues stalled ribosomes, especially those translating polyproline-containing peptides. EIF5A2 Protein, Human (His) is the recombinant human-derived EIF5A2 protein, expressed by E. coli , with N-6*His labeled tag.
  • Product Name Alternative :

    EIF5A2 Protein, Human (His), Human, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/eif5a2-protein-human-his.html
  • Smiles :

    MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
  • Molecular Formula :

    56648 (Gene_ID) Q9GZV4 (M1-K153) (Accession)
  • Molecular Weight :

    Approximately 22 kDa, based on SDS-PAGE under reducing conditions.
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Scientific Category :

    Recombinant Proteins

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide