EIF5A, Human (His)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


EIF5A, Human (His)
Description:
The GSK-3 beta protein is an enzyme that plays a crucial role in multiple cellular processes, including cell proliferation, differentiation, and apoptosis. It regulates various signaling pathways and is involved in the development of several diseases, such as cancer and neurodegenerative disorders. GSK-3 beta is active in its unphosphorylated form and can phosphorylate a wide range of substrates to modulate cellular functions. EIF5A Protein, Human (His) is the recombinant human-derived EIF5A protein, expressed by E. coli , with N-6*His labeled tag.Product Name Alternative:
EIF5A Protein, Human (His), Human, E. coliUNSPSC:
12352202Type:
Recombinant ProteinsAssay Protocol:
https://www.medchemexpress.com/cytokines/eif5a-protein-human-his.htmlPurity:
95.0Smiles:
MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAKMolecular Formula:
1984 (Gene_ID) NP_001961 (M1-K154) (Accession)Molecular Weight:
Approximately 19 kDaShipping Conditions:
Room temperature in continental US; may vary elsewhere.Storage Conditions:
Stored at -20°C for 2 yearsScientific Category:
Recombinant Proteins
