IL-3, Human (CHO)

• Description:

  IL-3 Protein, Human (CHO) is a multilineage hematopoietic cytokine with promising effects on platelet and neutrophil counts and special usefulness in patients with secondary hematopoietic failure.

• Product Name Alternative:

  IL-3 Protein, Human (CHO), Human, CHO

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/il-3-protein-human-cho.html

• Purity:

  95.00

• Smiles:

  APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

• Molecular Formula:

  3562 (Gene_ID) P08700 (A20-F152) (Accession)

• Molecular Weight:

  Approximately 16-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• References & Citations:

  [1]Huhn RD, et al. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF) in normal volunteers. Exp Hematol. 1996 Jun;24 (7) :839-47.|[2]Dagar VK, et al. Combined effect of gene dosage and process optimization strategies on high-level production of recombinant human interleukin-3 (hIL-3) in Pichia pastoris fed-batch culture. Int J Biol Macromol. 2018 Mar;108:999-1009.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins