Recombinant Rat Chemokine (C-X-C motif) ligand 12 (Stromal cell-derived factor 1) protein (Cxcl12) (Active)
CAT:
399-CSB-AP001471RA-01
Size:
10 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Rat Chemokine (C-X-C motif) ligand 12 (Stromal cell-derived factor 1) protein (Cxcl12) (Active)
Gene Name:
Cxcl12UniProt:
Q9QZD1Expression Region:
22-89aaOrganism:
Rattus norvegicusTarget Sequence:
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKSNNRQVCIDPKLKWIQEYLDKALNK+RLKMTag:
Tag-FreeSource:
E.ColiField of Research:
ImmunologyAssay Type:
Active Protein & In Stock ProteinEndotoxin:
Less than 1.0 EU/µg as determined by LAL method.Purity:
>97% as determined by SDS-PAGE.Activity:
YesBioactivity:
Fully biologically active when compared to standard. The biological activity determined by a chemotaXIs bioassay using human peripheral blood monocytes is in a concentration range of 100-200 ng/ml.Length:
Full Length of Mature ProteinForm:
Lyophilized powderBuffer:
Lyophilized from a 0.2 µm filtered PBS, pH 7.4Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.Molecular Weight:
8.4 kDaStorage Conditions:
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.CAS Number:
9000-83-3