Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2) , partial (Active)

CAT:
399-CSB-MP023072HU2-01
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2) , partial (Active) - image 1
Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2) , partial (Active) - image 2
Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2) , partial (Active) - image 3
Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2) , partial (Active) - image 4
Thumbnail 1
Thumbnail 2
Thumbnail 3
Thumbnail 4

Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2) , partial (Active)

  • Gene Name:

    TACSTD2
  • UniProt:

    P09758
  • Expression Region:

    31-274aa
  • Organism:

    Homo sapiens
  • Target Sequence:

    QDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
  • Tag:

    C-terminal 10xHis-tagged
  • Source:

    Mammalian cell
  • Field of Research:

    Cancer
  • Assay Type:

    Active Protein & In Stock Protein
  • Relevance:

    May function as a growth factor receptor.
  • Endotoxin:

    Less than 1.0 EU/ug as determined by LAL method.
  • Purity:

    Greater than 95% as determined by SDS-PAGE.
  • Activity:

    Yes
  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Human TROP2 at 2 μg/mL can bind Anti-TROP2 recombinant antibody (CSB-RA023072MA1HU), the EC50 is 0.9108-1.640 ng/mL.
  • Length:

    Partial
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    30.3 kDa
  • References & Citations:

    "A missense mutation in the M1S1 gene found in a turkish patient with gelatinous droplike corneal dystrophy." Yildirim N., Muslumanoglu H., Isiksoy S., Sahin A., Baycu C., Artan S. Cornea 26:1017-1020 (2007)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • Protein Length:

    Partial
  • CAS Number:

    9000-83-3