Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2), partial (Active)

• Product Name Alternative:

  Cell surface glycoprotein Trop-2 (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1) (GA733-1) (M1S1) (TROP2)

• Abbreviation:

  Recombinant Human TACSTD2 protein, partial (Active)

• Gene Name:

  TACSTD2

• UniProt:

  P09758

• Expression Region:

  27-274aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

• Tag:

  C-terminal hFc1-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Cancer

• Relevance:

  Cell surface glycoprotein Trop-2 (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1) (GA733-1) (M1S1) (TROP2)

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  Measured in cell activity assay using U937 cells. The EC50 for this effect is 190.2-298.6 ng/ml.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  56.8 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial