PDGF-AA, Mouse

• Description :

  PDGF-AA Protein, Mouse is a member of PDGF family, binds to FDGFR, and may has the potential to enhance wound healing.

• Product Name Alternative :

  PDGF-AA Protein, Mouse, Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/pdgf-aa-protein-mouse.html

• Purity :

  97.00

• Smiles :

  SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKNRKRKRLKPT

• Molecular Formula :

  18590 (Gene_ID) P20033 (S87-T211) (Accession)

• Molecular Weight :

  Approximately 17-28.7 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]Zhao F, et al. Effect of platelet-derived growth factor-BB on gap junction and connexin43 in rat penile corpus cavernosum smooth muscle cells. Andrologia. 2018 Nov 23:e13200.|[2]Wu LW, et al. Platelet-derived growth factor-AA is a substantial factor in the ability of adipose-derived stem cells and endothelial progenitor cells to enhance wound healing. FASEB J. 2018 Sep 28:fj201800658R.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins