Recombinant Human Kidney-associated antigen 1 (KAAG1) (Active)
CAT:
399-CSB-BP871385HU-02
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No








Recombinant Human Kidney-associated antigen 1 (KAAG1) (Active)
- CAS Number: 9000-83-3
- Gene Name: KAAG1
- UniProt: Q9UBP8
- Expression Region: 1-84aa
- Organism: Homo sapiens
- Target Sequence: MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK
- Tag: C-terminal 10xHis-tagged
- Source: Baculovirus
- Field of Research: Cancer
- Assay Type: Active Protein & In Stock Protein
- Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Yes
- Bioactivity: Measured by its binding ability in a functional ELISA. Immobilized Human KAAG1 at 2 μg/mL can bind Anti-KAAG1 recombinant antibody (CSB-RA871385MA1HU). The EC50 is 4.924-6.034 ng/mL.
- Length: Full Length
- Form: Lyophilized powder
- Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 10.3 kDa
- References & Citations: "A new antigen recognized by cytolytic T lymphocytes on a human kidney tumor results from reverse strand transcription." Van den Eynde B.J., Gaugler B., Probst-Kepper M., Michaux L., Devuyst O., Lorge F., Weynants P., Boon T. . Exp. Med. 190:1793-1800 (1999)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.