Recombinant Human Kidney-associated antigen 1 (KAAG1) (Active)

Recombinant Human Kidney-associated antigen 1 (KAAG1) (Active)

• CAS Number: 9000-83-3
• Gene Name: KAAG1
• UniProt: Q9UBP8
• Expression Region: 1-84aa
• Organism: Homo sapiens
• Target Sequence: MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK
• Tag: C-terminal 6xHis-tagged
• Source: E.coli
• Field of Research: Cancer
• Assay Type: Active Protein & In Stock Protein
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Activity: Yes
• Bioactivity: Measured by its binding ability in a functional ELISA. Immobilized Human KAAG1 at 2 μg/mL can bind Anti-KAAG1 recombinant antibody (CSB-RA871385MA1HU). The EC50 is 2.040-2.284 ng/mL.
• Length: Full Length
• Form: Lyophilized powder
• Buffer: Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 15.9 kDa
• References & Citations: "A new antigen recognized by cytolytic T lymphocytes on a human kidney tumor results from reverse strand transcription." Van den Eynde B.J., Gaugler B., Probst-Kepper M., Michaux L., Devuyst O., Lorge F., Weynants P., Boon T. . Exp. Med. 190:1793-1800 (1999)
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.