Recombinant Human Thymosin beta-4 (TMSB4X) (Active)

CAT:
399-CSB-AP000381HU-01
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Thymosin beta-4 (TMSB4X) (Active) - image 1

Recombinant Human Thymosin beta-4 (TMSB4X) (Active)

  • Gene Name:

    TMSB4X, TB4X, THYB4, TMSB4
  • UniProt:

    P62328
  • Expression Region:

    2-44aa
  • Organism:

    Homo sapiens
  • Target Sequence:

    SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Tag:

    Tag-Free
  • Source:

    E.Coli
  • Field of Research:

    Signal Transduction
  • Assay Type:

    Active Protein & In Stock Protein
  • Relevance:

    Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. {ECO:0000250}.; Seraspenide inhibits the entry of hematopoietic pluripotent stem cells into the S-phase. {ECO:0000250}.
  • Endotoxin:

    Less than 1.0 EU/µg as determined by LAL method.
  • Purity:

    >97% as determined by SDS-PAGE.
  • Activity:

    Yes
  • Bioactivity:

    Fully biologically active when compared to standard. The biological activity determined by its ability to produce a protective effect against hydrogen peroxide in primary lung fibroblasts is in a concentration range of 0.5 - 10 μg/ml.
  • Length:

    Full Length of Mature Protein
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 µm filtered concentrated solution in 20 mM PB, pH 7.4.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization.
  • Molecular Weight:

    4.9 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • CAS Number:

    9000-83-3