Recombinant Mouse Thymosin beta-10 (Tmsb10)
CAT:
399-CSB-EP765096MO-01
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Mouse Thymosin beta-10 (Tmsb10)
- CAS Number: 9000-83-3
- Gene Name: Tmsb10
- UniProt: Q6ZWY8
- Expression Region: 2-44aa
- Organism: Mus musculus
- Target Sequence: ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
- Tag: N-terminal 6xHis-SUMO-tagged
- Source: E.coli
- Field of Research: Signal Transduction
- Assay Type: In Stock Protein
- Relevance: Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization (By similarity).
- Purity: Greater than 85% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Full Length of Mature Protein
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 17.8 kDa
- References & Citations: "Fetal and trophoblast PI3K p110alpha have distinct roles in regulating resource supply to the growing fetus in mice." Lopez-Tello J., Perez-Garcia V., Khaira J., Kusinski L.C., Cooper W.N., Andreani A., Grant I., Fernandez de Liger E., Lam B.Y., Hemberger M., Sandovici I., Constancia M., Sferruzzi-Perri A.N. Elife 8:0-0 (2019)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.