Recombinant Human Thymosin beta-4 (TMSB4X) (Active)
CAT:
399-CSB-AP000381HU-02
Size:
500 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Human Thymosin beta-4 (TMSB4X) (Active)
- CAS Number: 9000-83-3
- Gene Name: TMSB4X, TB4X, THYB4, TMSB4
- UniProt: P62328
- Expression Region: 2-44aa
- Organism: Homo sapiens
- Target Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Tag: Tag-Free
- Source: E.Coli
- Field of Research: Signal Transduction
- Assay Type: Active Protein & In Stock Protein
- Relevance: Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. {ECO:0000250}.; Seraspenide inhibits the entry of hematopoietic pluripotent stem cells into the S-phase. {ECO:0000250}.
- Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
- Purity: >97% as determined by SDS-PAGE.
- Activity: Yes
- Bioactivity: Fully biologically active when compared to standard. The biological activity determined by its ability to produce a protective effect against hydrogen peroxide in primary lung fibroblasts is in a concentration range of 0.5 - 10 μg/ml.
- Length: Full Length of Mature Protein
- Form: Lyophilized powder
- Buffer: Lyophilized from a 0.2 µm filtered concentrated solution in 20 mM PB, pH 7.4.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Function: Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization.
- Molecular Weight: 4.9 kDa
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.