Products for Research Use Only

Recombinant Human Lysosomal acid lipase/cholesteryl ester hydrolase (LIPA)

CAT: 0399-CSB-EP012972HU-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0399-CSB-EP012972HU-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Product Name Alternative
Cholesteryl esteraseLipase ASterol esterase
Abbreviation
Recombinant Human LIPA protein
Gene Name
LIPA
UniProt
P38571
Expression Region
22-399aa
Organism
Homo sapiens (Human)
Target Sequence
SGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ
Tag
N-terminal GST-tagged
Type
In Stock Protein
Source
E.coli
Field of Research
Metabolism
Relevance
Crucial for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles. Important in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation.
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Crucial for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles. Important in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation.
Molecular Weight
70 kDa
References & Citations
Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. The DNA sequence and comparative analysis of human chromosome 10.Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.Nature 429:375-381 (2004)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein

UniProtKB · P38571

Lysosomal acid lipase/cholesteryl ester hydrolase

LICH_HUMAN · Homo sapiens

View on UniProt ↗
Primary accession
P38571
Review status
UniProtKB reviewed (Swiss-Prot)
Gene
LIPA
Protein existence
1: Evidence at protein level
Organism
Homo sapiens (Human)
Taxonomy ID
9606
Alternative names
Acid cholesteryl ester hydrolase, LAL
EC number
3.1.1.13
Processing
Precursor
Secondary accessions
B2RBH5, D3DR29, Q16529, Q53H21, Q5T074, Q5T771, Q96EJ0
Protein keywords

Technical term

3D-structureDirect protein sequencingProteomics identificationReference proteome

Coding sequence diversity

Alternative splicing

Disease

Disease variant

PTM

Glycoprotein

Molecular function

Hydrolase

Biological process

Lipid degradationLipid metabolism

Cellular component

Lysosome

Domain

Signal

Alternative Products

CatalogName
322751-01LIPA (Lysosomal acid Lipase/cholesteryl ester Hydrolase, Acid cholesteryl ester Hydrolase, LAL, Cholesteryl esterase, Lipase A, Sterol esterase, LIPA)
223918-01LIPA (Lysosomal acid Lipase/cholesteryl ester Hydrolase, Acid cholesteryl ester Hydrolase, LAL, Cholesteryl esterase, Lipase A, Sterol esterase, LIPA) discontinued
322754-01LIPA (Lysosomal acid Lipase/cholesteryl ester Hydrolase, Acid cholesteryl ester Hydrolase, LAL, Cholesteryl esterase, Lipase A, Sterol esterase, LIPA) (HRP) discontinued
129112LIPA (Lysosomal Acid Lipase/Cholesteryl Ester Hydrolase, Acid Cholesteryl Ester Hydrolase, LAL, Cholesteryl Esterase, Lipase A, Sterol Esterase)
322752-01LIPA (Lysosomal acid Lipase/cholesteryl ester Hydrolase, Acid cholesteryl ester Hydrolase, LAL, Cholesteryl esterase, Lipase A, Sterol esterase, LIPA) (Biotin) discontinued
322753-01LIPA (Lysosomal acid Lipase/cholesteryl ester Hydrolase, Acid cholesteryl ester Hydrolase, LAL, Cholesteryl esterase, Lipase A, Sterol esterase, LIPA) (FITC) discontinued
abx109975-01Lysosomal Acid Lipase/Cholesteryl Ester Hydrolase (LIPA) Antibody
227794Lysosomal Acid Lipase (Cholesteryl Ester Hydrolase, Cholesteryl Esterase, Lipase A, Sterol Esterase, LIPA)
129112-APCLIPA (Lysosomal Acid Lipase/Cholesteryl Ester Hydrolase, Acid Cholesteryl Ester Hydrolase, LAL, Cholesteryl Esterase, Lipase A, Sterol Esterase) (APC)
129112-HRPLIPA (Lysosomal Acid Lipase/Cholesteryl Ester Hydrolase, Acid Cholesteryl Ester Hydrolase, LAL, Cholesteryl Esterase, Lipase A, Sterol Esterase) (HRP)