Products for Research Use Only
RegisterLogin

Enterotoxin type C-2, S. aureus

CAT: 0804-HY-P71465Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P71465Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Enterotoxin type C-2 (SEC2) activates the host immune system by binding the unprocessed molecule to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction forms a ternary complex that activates a large number of T lymphocytes and triggers the widespread release of proinflammatory cytokines. Enterotoxin type C-2 Protein, S. aureus is the recombinant Staphylococcus aureus-derived Enterotoxin type C-2 protein, expressed by E. coli , with tag free.
Product Name Alternative
Enterotoxin type C-2 Protein, S. aureus, Staphylococcus aureus, E. coli
UNSPSC
12352202
Hazard Statement
H302+H332
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/enterotoxin-type-c-2-protein-s-aureus.html
Smiles
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Molecular Formula
/ (Gene_ID) P34071 (E28-G266) (Accession)
Molecular Weight
Approximately 27.6 kDa
Precautions
H302+H332
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P71509-01Enterotoxin type A, S. aureus (His)
HY-P72058A-01Enterotoxin type E, S. aureus (His)
HY-P71486Enterotoxin type G, S. aureus (His-SUMO)
HY-P72059Enterotoxin type A, S. aureus (sf9, His-Myc)
HY-P71808-01Enterotoxin type B, S. aureus (P.pastoris, His)
HY-P704080-01Enterotoxin type E, S. aureus (HEK293, His, Myc)
HY-P71807Enterotoxin type H, S. aureus (P.pastoris, His)
HY-E70234-01Sortase A, S. aureus
HY-P72780-01Staphylokinase, S. aureus
HY-P71581-01Clumping factor A, S. aureus

Alternative Products

CatalogName
MBS9420957-01Recombinant Staphylococcus aureus Enterotoxin type C-2
RPC22590-01Recombinant Staphylococcus aureus Enterotoxin type C-2 (entC2)
AP71075-01Recombinant Staphylococcus aureus Enterotoxin type C-2(entC2)
TMPH-03542-01Enterotoxin type C-2 Protein, S. aureus, Recombinant
S7965-31QStaphylococcus aureus, Enterotoxin A (Enterotoxin Type A, SEA, entA)
MBS9421009-01Recombinant Staphylococcus aureus Enterotoxin type C-3
MBS9421059-01Recombinant Staphylococcus aureus Enterotoxin type C-1
335664-01Staphylococcus aureus Enterotoxin type C-1 (entC1)
CSB-RP163894Ba-01Staphylococcus aureus Enterotoxin type A (entA)
335668-01Staphylococcus aureus Enterotoxin type C-3 (entC3)

Popular Products