Clumping factor A, S. aureus

• Description :

  Clustering factor A (ClfA) is a virulence-related cell surface-associated protein that plays a key role in bacterial pathogenicity. It promotes bacterial attachment exclusively to the gamma chain of human fibrinogen, demonstrating the specificity of its interaction with host proteins. Clumping factor A Protein, S. aureus is the recombinant Staphylococcus aureus-derived Clumping factor A protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  Clumping factor A Protein, S. aureus, Staphylococcus aureus, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/clumping-factor-a-protein-s-aureus.html

• Purity :

  97.00

• Smiles :

  GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYDSRFVWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

• Molecular Formula :

  / (Gene_ID) Q6GB45 (G228-E558) (Accession)

• Molecular Weight :

  Approximately 43 kDa. The reducing (R) protein migrat es as 43 kDa in SDS-PAGE may be due to relative Charge.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins