Products for Research Use Only
RegisterLogin

Clumping factor A, S. aureus

CAT: 0804-HY-P71581-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P71581-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Clustering factor A (ClfA) is a virulence-related cell surface-associated protein that plays a key role in bacterial pathogenicity. It promotes bacterial attachment exclusively to the gamma chain of human fibrinogen, demonstrating the specificity of its interaction with host proteins. Clumping factor A Protein, S. aureus is the recombinant Staphylococcus aureus-derived Clumping factor A protein, expressed by E. coli , with tag free.
Product Name Alternative
Clumping factor A Protein, S. aureus, Staphylococcus aureus, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/clumping-factor-a-protein-s-aureus.html
Purity
97.00
Smiles
GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYDSRFVWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE
Molecular Formula
/ (Gene_ID) Q6GB45 (G228-E558) (Accession)
Molecular Weight
Approximately 43 kDa. The reducing (R) protein migrat es as 43 kDa in SDS-PAGE may be due to relative Charge.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-E70234-01Sortase A, S. aureus
HY-P72780-01Staphylokinase, S. aureus
HY-P703433-01SrtA Protein, S. aureus
HY-P71484-01Exfoliative toxin A, S. aureus (His)
HY-P71509-01Enterotoxin type A, S. aureus (His)
HY-P71476-01MecA, S. aureus (His-SUMO)
HY-P71624-01Staphopain B, S. aureus (GST)
HY-P72058ENTE, S. aureus (sf9, His)
HY-P71508-01TSST-1, S. aureus (His-SUMO)
HY-P703505Peptide deformylase, S. aureus (His, SUMO)

Alternative Products

CatalogName
172283-01Staphylococcus Aureus Clumping Factor A (Staph Clumping Factor A) discontinued
abx346380-01Staphylococcus aureus Clumping Factor A (S. aureus clfA) Antibody
MBS1378726-01Recombinant Staphylococcus aureus Clumping factor B
MBS1448928-01Recombinant Staphylococcus aureus Clumping factor A (clfA), partial
AP74136-01Recombinant Staphylococcus aureus Clumping factor A(clfA) , partial
AP74269-01Recombinant Staphylococcus aureus Clumping factor A(clfA), partial
AP76654Recombinant Staphylococcus aureus Clumping factor A (clfA) , partial

Popular Products