Recombinant Salmonella typhimurium Protein prgI (prgI), Biotinylated

CAT:
399-CSB-EP336905SXB-B-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Salmonella typhimurium Protein prgI (prgI), Biotinylated - image 1

Recombinant Salmonella typhimurium Protein prgI (prgI), Biotinylated

  • Abbreviation:

    Recombinant Salmonella typhimurium prgI protein, Biotinylated
  • Gene Name:

    PrgI
  • UniProt:

    P41784
  • Expression Region:

    1-80aa
  • Organism:

    Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
  • Target Sequence:

    MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR
  • Tag:

    N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    Required for invasion of epithelial cells.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    56.6 kDa
  • References & Citations:

    Complete genome sequence of Salmonella enterica serovar Typhimurium LT2.McClelland M., Sanderson K.E., Spieth J., Clifton S.W., Latreille P., Courtney L., Porwollik S., Ali J., Dante M., Du F., Hou S., Layman D., Leonard S., Nguyen C., Scott K., Holmes A., Grewal N., Mulvaney E. , Ryan E., Sun H., Florea L., Miller W., Stoneking T., Nhan M., Waterston R., Wilson R.K.Nature 413:852-856 (2001)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length