Products for Research Use Only

CD90 Recombinant Protein

CAT: 0384-NCP0357-01Size: 500 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-NCP0357-01Size:500 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Background
The Thy1/CD90 cell surface antigen is a GPI-anchored, developmentally regulated protein involved in signaling cascades that mediate neurite outgrowth, T cell activation, tumor suppression, apoptosis, and fibrosis. Thy1/CD90 is highly expressed on the surface of adult neurons and is thought to play a role in modulating adhesive and migratory events, such as neurite extension. Decreased Thy1/CD90 mRNA and protein expression is associated with the development of epithelial ovarian cancer, suggesting a role as a putative tumor suppressor gene of human ovarian cancer. Research studies indicate that Thy1/CD90 knockout mice have impaired cutaneous immune responses and abnormal retinal development. Thy1/CD90 is epigenetically regulated or deregulated in some disease states, such as pulmonary fibrosis. The potentially reversible hypermethylation of the Thy1/CD90 promoter offers the possibility of novel therapeutic options in this disease.
CAS Number
9000-83-3
Swiss Prot
P04216
Modification Site
NdeI-XhoI
Expression System
Pet-22b (+)
Tag
His-tag
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .
Solubility
PBS, 4M Urea, PH7.4
Molecular Weight
~17kDa
Storage Conditions
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Notes
For research use only, not for use in diagnostic procedure.
Host or Source
E.coli
AA Sequence
MQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC