Alpha Synuclein S87N Mutant Monomers

CAT:
400-SPR-499B
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: Yes
Alpha Synuclein S87N Mutant Monomers - image 1

Alpha Synuclein S87N Mutant Monomers

  • Background:

    Human alpha synuclein S87N mutant (HuS87N) has Ser87 mutated to the equivalent mouse residue Asn87, effectively making it a human-mouse chimeric protein. Despite sequence differences at only seven residues, or 5% of the total 140 amino acids, the aggregation rate of wild-type mouse α-syn (MsWT) is faster than wild-type human α-syn (HuWT) in vitro. In wild-type mouse models, MsWT fibrils are more efficient than HuWT fibrils at inducing pathology of endogenous mouse α-syn (1) . A53T or S87N substitutions in human α-syn substantially accelerate fibrilization rates in vitro (2,3) . Chimeric HuS87N fibrils show enhanced pathogenicity to wild-type mouse neurons, greater than HuWT, HuA53T, and MsWT fibrils (4) . HuS87N fibrils can be used as a more human-like alternative to MsWT fibrils to induce equivalent or greater endogenous α-syn seeding and pathology in wild-type mice.
  • Description:

    Human Recombinant Alpha Synuclein S87N Mutant Monomers
  • Product Name Alternative:

    Alpha Synuclein S87N, Alpha synuclein protein, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein
  • UNSPSC:

    12352202
  • UN Code:

    Non-hazardous
  • Hazard Statement:

    Non-hazardous
  • Gene ID:

    6622
  • Swiss Prot:

    P37840-1
  • Accession Number:

    NP_000336.1
  • Expression System:

    E. coli
  • Host:

    E. coli
  • Origin Species:

    Human
  • Target:

    Alpha Synuclein S87N Mutant
  • Conjugation:

    No Tag
  • Nature:

    Recombinant
  • Sequence:

    MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
  • Applications:

    WB | SDS PAGE | In vitro Assay
  • Field of Research:

    Neuroscience | Neurodegeneration | Alzheimer's Disease | Tangles & Tau | Neuroscience | Neurodegeneration | Parkinson's Disease | Synuclein | Neuroscience | Neurodegeneration | Multiple System Atrophy
  • Purification Method:

    Ion-exchange Purified
  • Purification:

    Ion-exchange Purified
  • Limit Of Detection:

    Protein certified >95% pure on SDS-PAGE & Nanodrop analysis. Low endotoxin <5 EU/mL @ 2mg/mL.
  • Concentration:

    2 mg/ml or 5 mg/ml
  • Purity:

    >95%
  • Weight:

    0.01
  • Length:

    140 AA
  • Buffer:

    1X PBS pH 7.4
  • Molecular Weight:

    14.46 kDa
  • Precautions:

    Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
  • Additionnal Information:

    For corresponding PFFs, see catalog# SPR-500
  • References & Citations:

    1. Masuda-Suzukake et al. 2013. Prion-like Spreading of Pathological α-synuclein in Brain. Brain. https://doi.org/10.1093/braiwt037 2. Kang, K. et al. 2011. The A53T Mutation is Key in Defining the Differences in the Aggregation Kinetics of Human and Mouse α-synuclein. JACS. https://doi.org/10.1021/ja203979j 3. Ohgita, T. et al. 2023. Intramolecular Interaction Kinetically Regulates Fibril Formation by Human and Mouse Alpha-Synuclein. Sci Rep https://doi.org/10.1038/s41598-023-38070-4 4. Luk, K., C. et al. 2016. Molecular and Biological Compatibility with Host Alpha-Synuclein Influences Fibril Pathogenicity. Cell Rep. https://doi.org/10.1016/j.celrep.2016.08.053
  • Shipping Conditions:

    Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
  • Storage Conditions:

    -80ºC
  • Notes:

    For corresponding PFFs, see catalog# SPR-500
  • Protein Length:

    140 AA
  • Background Reference 01:

    1. Masuda-Suzukake et al. 2013. Prion-like Spreading of Pathological α-synuclein in Brain. Brain. https://doi.org/10.1093/brain/awt037 2. Kang, K. et al. 2011. The A53T Mutation is Key in Defining the Differences in the Aggregation Kinetics of Human and Mouse α-synuclein. JACS. https://doi.org/10.1021/ja203979j 3. Ohgita, T. et al. 2023. Intramolecular Interaction Kinetically Regulates Fibril Formation by Human and Mouse Alpha-Synuclein. Sci Rep https://doi.org/10.1038/s41598-023-38070-4 4. Luk, K., C. et al. 2016. Molecular and Biological Compatibility with Host Alpha-Synuclein Influences Fibril Pathogenicity. Cell Rep. https://doi.org/10.1016/j.celrep.2016.08.053
  • AA Sequence:

    MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
  • Immunogen Species:

    Human

MSDS

MSDS Document

View Document