RecombinantIL-1α, Rat
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


RecombinantIL-1α, Rat
Description :
Interleukin-1 alpha (IL-1α), is produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1alpha and IL-1beta bind to the same receptor and have similar if not identical biological properties. These cytokines have a broad range of activities including stimulation of thymocyte proliferation via IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity, and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1beta is a secreted cytokine, IL-1alpha is predominantly a cell-associated cytokine.CAS Number :
9000-83-3Endotoxin :
< 0.2 EU/μg, determined by LAL method.Purity :
> 95% as analyzed by SDS-PAGE.Bioactivity :
ED50 <5 pg/ml, measured in a proliferation assay using D10S cells.Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.Molecular Weight :
17~22 kDa, observed by reducing SDS-PAGE.Storage Conditions :
Lyophilized recombinant Rat Interleukin-1 alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Interleukin-1 alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C.Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.Formulation :
Lyophilized after extensive dialysis against PBS.Host or Source :
CHORecommended Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.AA Sequence :
APHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLF VSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS

