RecombinantIL-1α, Rat

CAT:
384-BK0237-01
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
RecombinantIL-1α, Rat - image 1

RecombinantIL-1α, Rat

  • Description :

    Interleukin-1 alpha (IL-1α), is produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1alpha and IL-1beta bind to the same receptor and have similar if not identical biological properties. These cytokines have a broad range of activities including stimulation of thymocyte proliferation via IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity, and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1beta is a secreted cytokine, IL-1alpha is predominantly a cell-associated cytokine.
  • Endotoxin :

    < 0.2 EU/μg, determined by LAL method.
  • Purity :

    > 95% as analyzed by SDS-PAGE.
  • Bioactivity :

    ED50 <5 pg/ml, measured in a proliferation assay using D10S cells.
  • Reconstitution :

    Reconstituted in ddH2O or PBS at 100 μg/ml.
  • Molecular Weight :

    17~22 kDa, observed by reducing SDS-PAGE.
  • Storage Conditions :

    Lyophilized recombinant Rat Interleukin-1 alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Interleukin-1 alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C.
  • Appearance :

    Sterile Filtered White lyophilized (freeze-dried) powder.
  • Formulation :

    Lyophilized after extensive dialysis against PBS.
  • Host or Source :

    CHO
  • Recommended Usage :

    This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
  • CAS Number :

    9000-83-3
  • AA Sequence :

    APHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLF VSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide