Products for Research Use Only
RegisterLogin

Recombinant Rat Interferon-γ (rRtFN-γ)

CAT: 0384-PR3008-01Size: 1 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-PR3008-01Size:1 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Interferon-gamma (IFN-γ, also known as Type II interferon or immune interferon) is a cytokine produced primarily by T-lymphocytes and natural killer cells. The protein shares no significant homology with IFN-β or the various IFN-α family proteins. Mature IFN-γ exists as noncovalently-linked homodimers. Human IFN-γ is highly species specific and is biologically active only in human and primate cells. IFN-γ was originally characterized based on its antiviral activities. The protein also exerts antiproliferative, immunoregulatory and proinflammatory activities and is thus important in host defense mechanisms. IFN-γ induces the production of cytokines, upregulates the expression of class I and II MHC antigens, Fc receptor and leukocyte adhesion molecules. It modulates macrophage effector functions, influences isotype switching and potentiates the secretion of immunoglobulins by B cells. IFN-γ also augments TH1 cell expansion and may be required for TH1 cell differentiation.
CAS Number
9000-83-3
Endotoxin
Less than 1EU/mg of rRaIFN-γ as determined by LAL method.
Purity
>95% by SDS-PAGE and HPLC analyses.
Bioactivity
Measured in an antiviral assay using L929 mouse fibrosarcoma cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is typically 1-3 ng/mL, corresponding to a Specific Activity of > 3.3 x 105 IU/mg.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
Molecular Weight
Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 135 amino acids.
Storage Conditions
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Host or Source
Escherichia coli.
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China
AA Sequence
MQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Related Products

CatalogName
PR2019-01Recombinant Murine Interferon-γ (rMuIFN-γ)
PR1049-01Recombinant Human Interferon-γ (rHuIFN-γ)
BS48410-01Interferon beta Recombinant Rabbit mAb
BS49508-01Interferon gamma Recombinant Rabbit mAb
PR1048-01Recombinant Human Interferon-α2b (rHuIFN-α2b)
BS47917Interferon regulatory factor 9 Recombinant Rabbit mAb
BS46764-01Interferon Regulatory Factor 4 Recombinant Rabbit mAb
PR1050-01Recombinant Human Interferon-λ1 (rHu IFN-λ1)
BS90728Interferon γ polyclonal antibody
BS47299-01Interferon alpha/beta Receptor 1 Recombinant Rabbit mAb

Alternative Products

CatalogName
JOT-PR3008Recombinant Rat Interferon-γ (rRtFN-γ)
GTR18991695-01Recombinant Rat Interferon-γ (rRtFN-γ)
CC117-101Recombinant Human Interferon-γ
048906Interferon A, Recombinant, Human
143365-01Interferon beta, Recombinant, Human (Leukocyte interferon, B cell interferon, Type I interferon, IFN-β) discontinued
500080IFNB1, Recombinant, Human (IFN-Beta, Immune Interferon, Fibroblast Interferon, Leukocyte Interferon, B Cell Interferon, Type I Interferon, Interferon-Beta 1A) discontinued
P1298-.1Recombinant Human Interferon-alpha1a
P1303-.5Recombinant Human Interferon-omega
048907Interferon Gamma, Recombinant, Human
GWB-E8E1CEInterferon Alpha A (Recombinant) Mouse

Popular Products