Products for Research Use Only
RegisterLogin

Recombinant Murine Interferon-γ (rMuIFN-γ)

CAT: 0384-PR2019-01Size: 1 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-PR2019-01Size:1 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Interferon-gamma (IFN-γ, also known as Type II interferon or immune interferon) is a cytokine produced primarily by T-lymphocytes and natural killer cells. The protein shares no significant homology with IFN-β or the various IFN-α family proteins. Mature IFN-γ exists as noncovalently-linked homodimers. Human IFN-γ is highly species specific and is biologically active only in human and primate cells.IFN-γ was originally characterized based on its antiviral activities. The protein also exerts antiproliferative, immunoregulatory and proinflammatory activities and is thus important in host defense mechanisms. IFN-γ induces the production of cytokines, upregulates the expression of class I and II MHC antigens, Fc receptor and leukocyte adhesion molecules. It modulates macrophage effector functions, influences isotype switching and potentiates the secretion of immunoglobulins by B cells. IFN-γ also augments TH1 cell expansion and may be required for TH1 cell differentiation.
CAS Number
9000-83-3
Endotoxin
Less than 1EU/mg of rMuIFN-γ as determined by LAL method.
Purity
>95% by SDS-PAGE and HPLC analyses
Bioactivity
Encephalomyocarditis (EMC) virus. The ED50 for this effect is typically 0.2- 0.8ng/mL, corresponding to a Specific Activity of > 1.25 x 106 IU/mg.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
Molecular Weight
Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 134 amino acids.
Storage Conditions
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4, containing 5% trehalose.
Host or Source
Escherichia coli.
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China
AA Sequence
MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

Related Products

CatalogName
PR2025-01Recombinant Murine Interleukin-4 (rMuIL-4)
PR2022-01Recombinant Murine Interleukin-2 (rMuIL-2)
PR2024-01Recombinant Murine Interleukin-33 (rMuIL-33)
PR2026-01Recombinant Murine Interleukin-6 (rMuIL-6)
PR2023-01Recombinant Murine Interleukin-3 (rMuIL-3)
PR2021-01Recombinant Murine Interleukin-10 (rMuIL-10)
PR2036-01Recombinant Murine Tumor Necrosis Factor-alpha (rMuTNF-α)
PR2020-01Recombinant Murine Interleukin-1 beta (rMuIL-1β)
PR2034-01Recombinant Murine SF20 (rMuSF20)
PR2032-01Recombinant Murine NOGGIN (rMuNOGGIN)

Alternative Products

CatalogName
JOT-PR2019Recombinant Murine Interferon-γ (rMuIFN-γ)
GTR18991697-01Recombinant Murine Interferon-γ (rMuIFN-γ)
P1356-.1Recombinant Murine Interferon-lambda3/Interleukin-28B
GTR19033526-01Recombinant Murine Interferon-lambda2/Interleukin-28A
GTR19033652-01Recombinant Murine Monokine Induced by Interferon-gamma/CXCL9
P1488-.1Recombinant Murine gamma-Interferon Inducible Protein 10/CXCL10
RC237-17IFN gamma, Interferon gamma, murine (mouse)
P1362-.005Recombinant Murine Persephin
P1493-.005Recombinant Murine CXCL16
P1407-.005Recombinant Murine Neuropoietin

Popular Products