Products for Research Use Only
RegisterLogin

PP1MG, Human (His)

CAT: 0804-HY-P71022-01Size: 10 µgDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P71022-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
PP1MG Protein, a member of PPM family of serine/threonine phosphatases, has an important role in controlling cell cycle progression. PP1MG Proteinregulates the phosphorylation of SRSF3 in hepatocellular carcinoma (HCC) and contributes to the proliferation, invasion, and metastasis of HCC. PP1MG Protein forms a distinct holoenzyme complex with the PP2A regulatory subunit B56δ. B56δ‐PPM1G dephosphorylates α‐catenin at serine 641, which is necessary for the appropriate assembly of adherens junctions and the prevention of aberrant cell migration[1][2]. PP1MG Protein, Human (His) is the recombinant human-derived PP1MG protein, expressed by E. coli , with C-6*His labeled tag.
Product Name Alternative
PP1MG Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pp1mg-protein-human-his.html
Purity
83.08
Smiles
MEGKEEPGSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAKRD
Molecular Formula
5496 (Gene_ID) O15355 (M317-D546) (Accession)
Molecular Weight
Approximately 30.0 kDa
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P70573A-01IRF5, Human (His)
HY-P705610METTL14, Human (His)
HY-P705479-01SFTPA1, Human (His)
HY-P705446RAF1, Human (His)
HY-P705436TIA1, Human (His)
HY-P705431METTL7B, Human (His)
HY-P705422-01NAT1, Human (His)
HY-P704865ITGB7, Human (His)
HY-P704253-01YAP1, Human (His)
HY-P704244-01PPARD, Human (His)

Alternative Products

CatalogName
MBS8433180-01Human PP1MG Recombinant Protein C-6 His Tag
IHUPP1MGRC6HIS50UGHuman PP1MG Recombinant Protein C-6 His Tag 50UG
C160-01Recombinant Human PP1MG (C-6His)
CD01093-01Recombinant Human PP1MG protein (C-6His)
C160-500ugRecombinant Human Protein Phosphatase 1G/PP1MG (C-6His)
ARP5443-01Recombinant Human Protein Phosphatase 1G/PP1MG Protein (C-6His)
PT_41578-01Myoglobin His Human Recombinant (Myoglobin His Human)
PT_P10118-01Prolactin Human Recombinant, His Tag (Prolactin Human, His)
PT_75053-01Adiponectin Human Recombinant, His tag (Acrp30 Human, His)
PT_74345-01DnaK Human Recombinant, His Tag (DnaK Human, His)

Popular Products