TSLP, Human

• Description :

  TSLP Protein, Human is an epithelial cell-derived cytokine which plays key role in allergic inflammation.

• Product Name Alternative :

  TSLP Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/tslp-protein-human.html

• Purity :

  98.0

• Smiles :

  YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

• Molecular Formula :

  85480 (Gene_ID) Q969D9-1 (Y29-Q159) (Accession)

• Molecular Weight :

  Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]He R, et al. Thymic stromal lymphopoietin. Ann N Y Acad Sci. 2010 Jan;1183:13-24.|[2]Ziegler SF, et al. The biology of thymic stromal lymphopoietin (TSLP) . Adv Pharmacol. 2013;66:129-55.|[3]Liu YJ, et al. Thymic stromal lymphopoietin: master switch for allergic inflammation. J Exp Med. 2006 Feb 20;203 (2) :269-73.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins