TSLP, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


TSLP, Human
Description:
TSLP Protein, Human is an epithelial cell-derived cytokine which plays key role in allergic inflammation.Product Name Alternative:
TSLP Protein, Human, Human, E. coliUNSPSC:
12352202Type:
Recombinant ProteinsAssay Protocol:
https://www.medchemexpress.com/cytokines/tslp-protein-human.htmlPurity:
98.0Smiles:
YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQMolecular Formula:
85480 (Gene_ID) Q969D9-1 (Y29-Q159) (Accession)Molecular Weight:
Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions.References & Citations:
[1]He R, et al. Thymic stromal lymphopoietin. Ann N Y Acad Sci. 2010 Jan;1183:13-24.|[2]Ziegler SF, et al. The biology of thymic stromal lymphopoietin (TSLP) . Adv Pharmacol. 2013;66:129-55.|[3]Liu YJ, et al. Thymic stromal lymphopoietin: master switch for allergic inflammation. J Exp Med. 2006 Feb 20;203 (2) :269-73.Shipping Conditions:
Room temperature in continental US; may vary elsewhere.Storage Conditions:
Stored at -20°C for 2 yearsScientific Category:
Recombinant Proteins
