Recombinant Human Laminin subunit gamma-2 (LAMC2), partial

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS634478-02	Laminin, Human (Laminin-1)
MBS634478-01	Laminin, Human (Laminin-1)
MBS8506840-02	Human Laminin
MBS634390-01	Laminin, Human
MBS634390-02	Laminin, Human
MBS8506840-01	Human Laminin
B2017068	Recombinant Laminin
MBS634407-01	Laminin 5, Human (Laminin gamma 2)
MBS634407-02	Laminin 5, Human (Laminin gamma 2)
MBS7608793-01	Recombinant Human Laminin alpha 5

CAT:

399-CSB-EP618803HU-03

Size:

20 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Laminin subunit gamma-2 (LAMC2), partial

Gene Name: LAMC2
UniProt: Q13753
Expression Region: 417-588aa
Organism: Homo sapiens
Target Sequence: NCQGGGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVVCNNCPPGVTGARCELCADGYFGDPFGEHGPVRPCQPCQCNNNVDPSASGNCDRLTGRCLKCIHNTAGIYCDQCKAGYFGDPLAPNPADKCRACNCNPMGSEPVGCRSD
Tag: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Source: E.coli
Field of Research: Neuroscience
Assay Type: Developed Protein
Relevance: Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Ladsin exerts cell-scattering activity toward a wide variety of cells, including epithelial, endothelial, and fibroblastic cells
Purity: Greater than 85% as determined by SDS-PAGE.
Activity: Not Test
Length: Partial
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 53.3 kDa
References & Citations: "Structure of the human laminin gamma 2 chain gene (LAMC2): alternative splicing with different tissue distribution of two transcripts." Airenne T., Haakana H., Sainio K., Kallunki T., Kallunki P., Sariola H., Tryggvason K. Genomics 32:54-64 (1996)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Laminin subunit gamma-2 (LAMC2), partial, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on

Cat	Name
CSB-YP618803HU-03	Recombinant Human Laminin subunit gamma-2 (LAMC2), partial
CSB-EP618803HU-02	Recombinant Human Laminin subunit gamma-2 (LAMC2), partial
CSB-EP012731HU-01	Recombinant Human Laminin subunit beta-2 (LAMB2), partial
CSB-EP012729HU-01	Recombinant Human Laminin subunit alpha-5 (LAMA5), partial
CSB-EP012729HU-03	Recombinant Human Laminin subunit alpha-5 (LAMA5), partial
CSB-EP012730HU-02	Recombinant Human Laminin subunit beta-1 (LAMB1), partial
CSB-EP012730HU-01	Recombinant Human Laminin subunit beta-1 (LAMB1), partial
CSB-EP012730HU-03	Recombinant Human Laminin subunit beta-1 (LAMB1), partial
CSB-EP012729HU-02	Recombinant Human Laminin subunit alpha-5 (LAMA5), partial
CSB-EP618803HU-03	Recombinant Human Laminin subunit gamma-2 (LAMC2), partial