Recombinant Human SIN3-HDAC complex-associated factor (SINHCAF) (Active)
CAT:
399-CSB-EP882059HUe0-01
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No








Recombinant Human SIN3-HDAC complex-associated factor (SINHCAF) (Active)
- CAS Number: 9000-83-3
- Gene Name: SINHCAF
- UniProt: Q9NP50
- Expression Region: 1-221aa
- Organism: Homo sapiens
- Target Sequence: MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW
- Tag: N-terminal GST-tagged
- Source: E.coli
- Field of Research: Cancer
- Assay Type: Active Protein & Developed Protein
- Relevance: Subunit of the Sin3 deacetylase complex, this subunit is important for the repression of genes encoding components of the TGF-beta signaling pathway . Core component of a SIN3A complex present in embryonic stem cells. Promotes the stability of SIN3A and its presence on chromatin and is essential for maintaining the potential of ES cells to proliferate rapidly, while ensuring a short G1-phase of the cell cycle, thereby preventing premature lineage priming.
- Purity: Greater than 85% as determined by SDS-PAGE.
- Activity: Yes
- Bioactivity: Measured by its binding ability in a functional ELISA. Immobilized LCN2 at 2 μg/ml can bind human SINHCAF, the EC50 of human SINHCAF protein is 31.54-38.59 μg/ml.
- Length: Full Length
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 51.9 kDa
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.