Products for Research Use Only
RegisterLogin

CD70, Mouse (HEK293, mFc)

CAT: 0804-HY-P72928Size: 50 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P72928Size:50 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
CD70 is the ligand of CD27 in activated T and B lymphocytes, is an important cytokine in CD70-CD27 pathway involving with the generation and maintenance of T cell immunity[1]. CD70 is a surface antigen, also shows antiviral activity and regulates viability of tumor cells and regulatory T cells[2][3]. As for CD70 protein in mouse contains TNF_2 domain (60-190 a.a) and transmembrane helix, belonging to the tumor necrosis factor (TNF) family. CD70 Protein, Mouse (HEK293, mFc) is 149 amino acids in length (Q47-P195) and is expressed in the HEK293 cells with N terminal mFc-tag.
Product Name Alternative
CD70 Protein, Mouse (HEK293, mFc), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd70-protein-mouse-hek293-fc.html
Purity
96.80
Smiles
QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP
Molecular Formula
21948 (Gene_ID) Q05A52 (Q47-P195) (Accession)
Molecular Weight
Approximately 43.1 kDa
References & Citations
[1]Bowman MR, et al. The cloning of CD70 and its identification as the ligand for CD27. J Immunol. 1994 Feb 15;152 (4) :1756-61.|[2]Jacobs J, et al. CD70: An emerging target in cancer immunotherapy. Pharmacol Ther. 2015 Nov;155:1-10.|[3]Izawa K, et al. Inherited CD70 deficiency in humans reveals a critical role for the CD70-CD27 pathway in immunity to Epstein-Barr virus infection. J Exp Med. 2017 Jan;214 (1) :73-89.|[4]Brown GR, et al. CD27-CD27 ligand/CD70 interactions enhance alloantigen-induced proliferation and cytolytic activity in CD8+ T lymphocytes. J Immunol. 1995 Apr 15;154 (8) :3686-95.|[5]Kobata T, et al. CD27-CD70 interactions regulate B-cell activation by T cells. Proc Natl Acad Sci U S A. 1995 Nov 21;92 (24) :11249-53.|[6]Jin L, et al. CD70, a novel target of CAR T-cell therapy for gliomas. Neuro Oncol. 2018 Jan 10;20 (1) :55-65.|[7]Boursalian TE, et al. Targeting CD70 for human therapeutic use. Adv Exp Med Biol. 2009;647:108-19.|[8]Arens R, et al. Signaling through CD70 regulates B cell activation and IgG production. J Immunol. 2004 Sep 15;173 (6) :3901-8.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P704279CD70, Human (HEK293, mFc)
HY-P72741CD70, Mouse (HEK293, His)
HY-P78710CD47, Mouse (HEK293, mFc)
HY-P704857PVRIG, Mouse (HEK293, mFc)
HY-P704266LAIR1 , Mouse (HEK293, mFc)
HY-P78255CD24, Mouse (HEK293, mFc)
HY-P77235-01TIGIT, Mouse (HEK293, mFc)
HY-P704490CD79 , Human (HEK293, mFc-Flag, mFc-His)
HY-P704264CRACC/SLAMF7 , Mouse (HEK293, mFc)
HY-P704254PVR/CD155 , Mouse (HEK293, mFc)

Alternative Products

CatalogName
32-9832-500Recombinant Mouse CD70 (C-mFc)
TMPY-04497-01CD70 Protein, Mouse, Recombinant (mFc)
MBS8123154-01CD70 Protein, Mouse, Recombinant (mFc Tag)
MBS8117073-01Mouse CD70 HEK293 Overexpression Lysate
bs-47052P-01Recombinant mouse CD24 Protein, C-mFc (HEK293)
bs-43509P-01Recombinant mouse CD3E protein, C-mFc (HEK293)
bs-43533P-01Recombinant Mouse Thy-1 protein, C-mFc (HEK293)
GTR19077400-01Recombinant mouse TNFSF13B protein, N-mFc-Flag (HEK293)
bs-43509P-APC-01Recombinant mouse CD3E protein, C-mFc (HEK293), APC Conjugated
bs-43509P-Biotin-01Recombinant mouse CD3E protein, C-mFc (HEK293), Biotin Conjugated

Popular Products