IL-17D, Human

CAT:
804-HY-P70587-01
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
IL-17D, Human - image 1

IL-17D, Human

  • Description :

    IL-17D protein acts as a potent inducer, effectively triggering endothelial cells to express key inflammatory mediators such as IL6, CXCL8/IL8, and CSF2/GM-CSF. The ability of this cytokine to stimulate the production of pro-inflammatory signals emphasizes its importance in orchestrating immune responses, particularly in the context of endothelial cell activation. IL-17D Protein, Human is the recombinant human-derived IL-17D protein, expressed by E. coli , with tag free.
  • Product Name Alternative :

    IL-17D Protein, Human, Human, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/il-17d-protein-human.html
  • Purity :

    98.0
  • Smiles :

    APRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP
  • Molecular Formula :

    53342 (Gene_ID) Q8TAD2 (A18-P202) (Accession)
  • Molecular Weight :

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions :

    Stored at -20°C for 2 years
  • Scientific Category :

    Recombinant Proteins

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide